Product Browser

Last updated: 2014/7/28
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RPL23A monoclonal antibody (M10), clone 3E11

  • Catalog # : H00006147-M10
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant RPL23A.
  • Immunogen:
  • RPL23A (NP_000975.2, 59 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006147-M10
    Western Blot detection against Immunogen (36.52 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • RPL23A monoclonal antibody (M10), clone 3E11. Western Blot analysis of RPL23A expression in HeLa.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RPL23A expression in transfected 293T cell line by RPL23A monoclonal antibody (M10), clone 3E11.

    Lane 1: RPL23A transfected lysate(17.7 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6147
  • Gene Name:
  • RPL23A
  • Gene Alias:
  • FLJ27455,MDA20
  • Gene Description:
  • ribosomal protein L23a
  • Other Designations:
  • 60S ribosomal protein L23a,melanoma differentiation-associated gene 20
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook