RGS3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RGS3 expression in transfected 293T cell line (H00005998-T02) by RGS3 MaxPab polyclonal antibody.
Lane 1: RGS3 transfected lysate(18.48 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RGS3 protein.
Immunogen
RGS3 (NP_602299.1, 1 a.a. ~ 168 a.a) full-length human protein.
Sequence
MKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RGS3 expression in transfected 293T cell line (H00005998-T02) by RGS3 MaxPab polyclonal antibody.
Lane 1: RGS3 transfected lysate(18.48 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RGS3
Entrez GeneID
5998GeneBank Accession#
NM_134427Protein Accession#
NP_602299.1Gene Name
RGS3
Gene Alias
C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ-RGS3, RGP3
Gene Description
regulator of G-protein signaling 3
Omim ID
602189Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known. [provided by RefSeq
Other Designations
OTTHUMP00000022813|OTTHUMP00000022814|OTTHUMP00000022815|regulator of G-protein signalling 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com