RFC4 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RFC4 protein.
Immunogen
RFC4 (NP_002907.1, 1 a.a. ~ 363 a.a) full-length human protein.
Sequence
MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RFC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of RFC4 expression in human kidney.Western Blot (Cell lysate)
RFC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of RFC4 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of RFC4 expression in transfected 293T cell line (H00005984-T02) by RFC4 MaxPab polyclonal antibody.
Lane 1: RFC4 transfected lysate(39.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RFC4
Entrez GeneID
5984GeneBank Accession#
NM_002916Protein Accession#
NP_002907.1Gene Name
RFC4
Gene Alias
A1, MGC27291, RFC37
Gene Description
replication factor C (activator 1) 4, 37kDa
Omim ID
102577Gene Ontology
HyperlinkGene Summary
The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq
Other Designations
A1 37 kDa subunit|RFC 37 kDa subunit|activator 1 37 kDa subunit|replication factor C (activator 1) 4 (37kD)|replication factor C 4
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com