Product Browser

Last updated: 2014/10/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

REV3L polyclonal antibody (A01)

  • Catalog # : H00005980-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant REV3L.
  • Immunogen:
  • REV3L (NP_002903, 2953 a.a. ~ 3052 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQQEQLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005980-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5980
  • Gene Name:
  • REV3L
  • Gene Alias:
  • POLZ,REV3
  • Gene Description:
  • REV3-like, catalytic subunit of DNA polymerase zeta (yeast)
  • Other Designations:
  • OTTHUMP00000017933,OTTHUMP00000017934,OTTHUMP00000040457,Polymerase, DNA, zeta (Rev-3, yeast, homolog of),REV3-like, catalytic subunit of DNA polymerase zeta,Rev-3, yeast, homolog-like (polymerase, DNA, zeta)
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook