RBP4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RBP4 expression in transfected 293T cell line (H00005950-T01) by RBP4 MaxPab polyclonal antibody.
Lane 1: RBP4 transfected lysate(23.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RBP4 protein.
Immunogen
RBP4 (NP_006735.2, 1 a.a. ~ 201 a.a) full-length human protein.
Sequence
MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RBP4 expression in transfected 293T cell line (H00005950-T01) by RBP4 MaxPab polyclonal antibody.
Lane 1: RBP4 transfected lysate(23.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RBP4
Entrez GeneID
5950GeneBank Accession#
NM_006744.3Protein Accession#
NP_006735.2Gene Name
RBP4
Gene Alias
-
Gene Description
retinol binding protein 4, plasma
Omim ID
180250Gene Ontology
HyperlinkGene Summary
This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq
Other Designations
OTTHUMP00000020114|OTTHUMP00000020116|retinol-binding protein 4, interstitial|retinol-binding protein 4, plasma
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com