RAB27A monoclonal antibody (M01), clone 4C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAB27A.
Immunogen
RAB27A (NP_004571, 122 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAB27A monoclonal antibody (M01), clone 4C1. Western Blot analysis of RAB27A expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB27A is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — RAB27A
Entrez GeneID
5873GeneBank Accession#
NM_004580Protein Accession#
NP_004571Gene Name
RAB27A
Gene Alias
GS2, HsT18676, MGC117246, RAB27, RAM
Gene Description
RAB27A, member RAS oncogene family
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
GTP-binding protein Ram|Ras-related protein Rab-27A
-
Interactome
-
Disease
-
Publication Reference
-
GDP-bound Rab27a regulates clathrin disassembly through HSPA8 after insulin secretion.
Soshiro Kodera, Toshihide Kimura, Tomoki Nishioka, Yukiko K Kaneko, Momoka Yamaguchi, Kozo Kaibuchi, Tomohisa Ishikawa.
Archives of Biochemistry and Biophysics 2023 Nov; 749:109789.
Application:WB, Mouse, min6 cells.
-
A novel P53/POMC/Gαs/SASH1 autoregulatory feedback loop activates mutated SASH1 to cause pathologic hyperpigmentation.
Zhou D, Wei Z, Kuang Z, Luo H, Ma J, Zeng X, Wang K, Liu B, Gong F, Wang J, Lei S, Wang D, Zeng J, Wang T, He Y, Yuan Y, Dai H, He L, Xing Q.
Journal of Cellular and Molecular Medicine 2016 Nov; 21(4):802.
Application:IHC-P, WB, Human, Epithelial tissues from patients with dyschromatosis universalis hereditaria (DUH), NHEMs, SK‐MEL‐28 cells.
-
GDP-bound Rab27a regulates clathrin disassembly through HSPA8 after insulin secretion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com