PTK6 monoclonal antibody (M01), clone 2F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PTK6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PTK6.
Immunogen
PTK6 (NP_005966, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PTK6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — PTK6
Entrez GeneID
5753GeneBank Accession#
NM_005975Protein Accession#
NP_005966Gene Name
PTK6
Gene Alias
BRK, FLJ42088
Gene Description
PTK6 protein tyrosine kinase 6
Omim ID
602004Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues. Overexpression of this gene in mammary epithelial cells leads to sensitization of the cells to epidermal growth factor and results in a partially transformed phenotype. Expression of this gene has been detected at low levels in some breast tumors but not in normal breast tissue. The encoded protein has been shown to undergo autophosphorylation. [provided by RefSeq
Other Designations
OTTHUMP00000031656|breast tumor kinase|protein-tyrosine kinase BRK
-
Interactome
-
Disease
-
Publication Reference
-
Additive impact of HER2-/PTK6-RNAi on interactions with HER3 or IGF-1R leads to reduced breast cancer progression in vivo.
Falkenberg N, Anastasov N, Hofig I, Bashkueva K, Lindner K, Hofler H, Rosemann M, Aubele M.
Molecular Oncology 2015 Jan; 9(1):282.
Application：IHC, Mouse, BT474 cell xenografts.
-
Olive Phenolics as c-Met Inhibitors: (-)-Oleocanthal Attenuates Cell Proliferation, Invasiveness, and Tumor Growth in Breast Cancer Models.
Akl MR, Ayoub NM, Mohyeldin MM, Busnena BA, Foudah AI, Liu YY, Sayed KA.
PLoS One 2014 May; 9(5):e97622.
Application：WB-Ce, Human, MDA-MB-231 cells.
-
Additive impact of HER2-/PTK6-RNAi on interactions with HER3 or IGF-1R leads to reduced breast cancer progression in vivo.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com