Product Browser

Last updated: 2014/11/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTEN polyclonal antibody (A01)

  • Catalog # : H00005728-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PTEN.
  • Immunogen:
  • PTEN (AAH05821, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005728-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5728
  • Gene Name:
  • PTEN
  • Gene Alias:
  • 10q23del,BZS,MGC11227,MHAM,MMAC1,PTEN1,TEP1
  • Gene Description:
  • phosphatase and tensin homolog
  • Gene Summary:
  • This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded this gene is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway. [provided by RefSeq
  • Other Designations:
  • MMAC1 phosphatase and tensin homolog deleted on chromosome 10,OTTHUMP00000020032,mutated in multiple advanced cancers 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook