KLK7 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of KLK7 expression in transfected 293T cell line (H00005650-T02) by KLK7 MaxPab polyclonal antibody.
Lane 1: KLK7 transfected lysate(27.83 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human KLK7 protein.
Immunogen
KLK7 (NP_005037.1, 1 a.a. ~ 253 a.a) full-length human protein.
Sequence
MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KLK7 expression in transfected 293T cell line (H00005650-T02) by KLK7 MaxPab polyclonal antibody.
Lane 1: KLK7 transfected lysate(27.83 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — KLK7
Entrez GeneID
5650GeneBank Accession#
NM_005046.2Protein Accession#
NP_005037.1Gene Name
KLK7
Gene Alias
PRSS6, SCCE
Gene Description
kallikrein-related peptidase 7
Omim ID
604438Gene Ontology
HyperlinkGene Summary
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded enzyme is thought to be involved in the proteolysis of intercellular cohesive structures preceding desquamation, which is the shedding of the outermost layer of the epidermis. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq
Other Designations
kallikrein 7 (chymotryptic, stratum corneum)|protease, serine, 6|signal protein|stratum corneum chymotryptic enzyme
-
Interactome
-
Disease
- Asthma
- Birth Weight
- Dermatitis
- Eczema
- Genetic Predisposition to Disease
- Glioblastoma
- Glioma
- Leukemia
- Meningeal Neoplasms
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com