PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PRSS2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PRSS2 expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of PRSS2 expression in transfected 293T cell line (H00005645-T03) by PRSS2 MaxPab polyclonal antibody.
Lane 1: PRSS2 transfected lysate(26.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PRSS2 protein.
Immunogen
PRSS2 (NP_002761.1, 1 a.a. ~ 247 a.a) full-length human protein.
Sequence
MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (76)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PRSS2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PRSS2 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of PRSS2 expression in transfected 293T cell line (H00005645-T03) by PRSS2 MaxPab polyclonal antibody.
Lane 1: PRSS2 transfected lysate(26.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PRSS2
Entrez GeneID
5645GeneBank Accession#
NM_002770Protein Accession#
NP_002761.1Gene Name
PRSS2
Gene Alias
MGC111183, MGC120174, TRY2, TRY8, TRYP2
Gene Description
protease, serine, 2 (trypsin 2)
Omim ID
601564Gene Ontology
HyperlinkGene Summary
This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq
Other Designations
anionic trypsinogen|protease serine 2 preproprotein|protease, serine, 2|protease, serine, 2, preproprotein|trypsin 2|trypsin II|trypsinogen 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com