MAPK11 monoclonal antibody (M03), clone 1F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAPK11.
Immunogen
MAPK11 (AAH27933, 255 a.a. ~ 364 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAPK11 expression in transfected 293T cell line by MAPK11 monoclonal antibody (M03), clone 1F9.
Lane 1: MAPK11 transfected lysate(41.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAPK11 is approximately 10ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of MAPK11 over-expressed 293 cell line, cotransfected with MAPK11 Validated Chimera RNAi ( Cat # H00005600-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MAPK11 monoclonal antibody (M03) clone 1F9 (Cat # H00005600-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — MAPK11
Entrez GeneID
5600GeneBank Accession#
BC027933Protein Accession#
AAH27933Gene Name
MAPK11
Gene Alias
P38B, P38BETA2, PRKM11, SAPK2, SAPK2B, p38-2, p38Beta
Gene Description
mitogen-activated protein kinase 11
Omim ID
602898Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase. [provided by RefSeq
Other Designations
OTTHUMP00000196655|mitogen-activated protein kinase p38 beta|mitogen-activated protein kinase p38-2|stress-activated protein kinase-2|stress-activated protein kinase-2b
-
Interactome
-
Pathway
- Amyotrophic lateral sclerosis (ALS)
- Epithelial cell signaling in Helicobacter pylori infection
- Fc epsilon RI signaling pathway
- GnRH signaling pathway
- Leukocyte transendothelial migration
- MAPK signaling pathway
- Neurotrophin signaling pathway
- T cell receptor signaling pathway
- Toll-like receptor signaling pathway
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com