Product Browser

Last updated: 2014/12/14
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRKG1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00005592-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human PRKG1 protein.
  • Immunogen:
  • PRKG1 (AAH62688.1, 1 a.a. ~ 312 a.a) full-length human protein.
  • Sequence:
  • MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PRKG1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PRKG1 expression in IMR-32.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PRKG1 expression in transfected 293T cell line (H00005592-T02) by PRKG1 MaxPab polyclonal antibody.

    Lane 1: PRKG1 transfected lysate(35.50 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 5592
  • Gene Name:
  • PRKG1
  • Gene Alias:
  • CGKI,DKFZp686K042,FLJ36117,MGC71944,PGK,PKG,PRKG1B,PRKGR1B,cGKI-BETA,cGKI-alpha
  • Gene Description:
  • protein kinase, cGMP-dependent, type I
  • Other Designations:
  • OTTHUMP00000019619,OTTHUMP00000061216,protein kinase, cGMP-dependent, regulatory, type I, beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook