PRKCZ monoclonal antibody (M01), clone 2D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PRKCZ expression in transfected 293T cell line by PRKCZ monoclonal antibody (M01), clone 2D1.
Lane 1: PRKCZ transfected lysate(67.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRKCZ is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of PRKCZ over-expressed 293 cell line, cotransfected with PRKCZ Validated Chimera RNAi ( Cat # H00005590-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PRKCZ monoclonal antibody (M01) clone 2D1 (Cat # H00005590-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (35.42 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRKCZ.
Immunogen
PRKCZ (AAH08058, 165 a.a. ~ 255 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PRKCZ expression in transfected 293T cell line by PRKCZ monoclonal antibody (M01), clone 2D1.
Lane 1: PRKCZ transfected lysate(67.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRKCZ is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PRKCZ over-expressed 293 cell line, cotransfected with PRKCZ Validated Chimera RNAi ( Cat # H00005590-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PRKCZ monoclonal antibody (M01) clone 2D1 (Cat # H00005590-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PRKCZ
Entrez GeneID
5590GeneBank Accession#
BC008058Protein Accession#
AAH08058Gene Name
PRKCZ
Gene Alias
PKC-ZETA, PKC2
Gene Description
protein kinase C, zeta
Omim ID
176982Gene Ontology
HyperlinkGene Summary
Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000001368|OTTHUMP00000044160
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com