Product Browser
 
  • Related Product Showcase
  • By Research Area
  • By Pathway
  • By Biomarker
  • By Application
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

PRKCD monoclonal antibody (M07), clone 8E12   

  • Catalog # : H00005580-M07
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PRKCD.
  • Immunogen:
  • PRKCD (NP_006245, 577 a.a. ~ 676 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005580-M07
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PRKCD expression in transfected 293T cell line by PRKCD monoclonal antibody (M07), clone 8E12.

    Lane 1: PRKCD transfected lysate(77.5 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged PRKCD is approximately 1ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5580
  • Gene Name:
  • PRKCD
  • Gene Alias:
  • MAY1,MGC49908,PKCD,nPKC-delta
  • Gene Description:
  • protein kinase C, delta
  • Gene Summary:
  • Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq
  • Other Designations:
  • protein kinase C delta VIII
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!