POU4F3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of POU4F3 expression in transfected 293T cell line (H00005459-T01) by POU4F3 MaxPab polyclonal antibody.
Lane 1: POU4F3 transfected lysate(37.18 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human POU4F3 protein.
Immunogen
POU4F3 (NP_002691.1, 1 a.a. ~ 338 a.a) full-length human protein.
Sequence
MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSSTVPISHPAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of POU4F3 expression in transfected 293T cell line (H00005459-T01) by POU4F3 MaxPab polyclonal antibody.
Lane 1: POU4F3 transfected lysate(37.18 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — POU4F3
Entrez GeneID
5459GeneBank Accession#
NM_002700.1Protein Accession#
NP_002691.1Gene Name
POU4F3
Gene Alias
BRN3C, DFNA15, MGC138412
Gene Description
POU class 4 homeobox 3
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. This protein is found in the retina and may play a role in determining or maintaining the identities of a small subset of visual system neurons. Defects in this gene are the cause of non-syndromic sensorineural deafness autosomal dominant type 15. [provided by RefSeq
Other Designations
POU domain, class 4, transcription factor 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com