POLR2L purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of POLR2L expression in transfected 293T cell line (H00005441-T04) by POLR2L MaxPab polyclonal antibody.
Lane 1: POLR2L transfected lysate(7.60 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human POLR2L protein.
Immunogen
POLR2L (NP_066951.1, 1 a.a. ~ 67 a.a) full-length human protein.
Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of POLR2L expression in transfected 293T cell line (H00005441-T04) by POLR2L MaxPab polyclonal antibody.
Lane 1: POLR2L transfected lysate(7.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — POLR2L
Entrez GeneID
5441GeneBank Accession#
NM_021128.3Protein Accession#
NP_066951.1Gene Name
POLR2L
Gene Alias
RBP10, RPABC5, RPB10, RPB10beta, RPB7.6, hRPB7.6, hsRPB10b
Gene Description
polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
Omim ID
601189Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases. [provided by RefSeq
Other Designations
DNA directed RNA polymerase II polypeptide L|polymerase (RNA) II (DNA directed) polypeptide L (7.6kD)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com