PITX2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PITX2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PITX2 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of PITX2 expression in transfected 293T cell line (H00005308-T01) by PITX2 MaxPab polyclonal antibody.
Lane 1: PITX2 transfected lysate(30.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PITX2 and CTNNB1. HeLa cells were stained with anti-PITX2 rabbit purified polyclonal 1:1200 and anti-CTNNB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PITX2 protein.
Immunogen
PITX2 (NP_700476.1, 1 a.a. ~ 271 a.a) full-length human protein.
Sequence
METNCRKLVSACVQLEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PITX2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PITX2 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of PITX2 expression in transfected 293T cell line (H00005308-T01) by PITX2 MaxPab polyclonal antibody.
Lane 1: PITX2 transfected lysate(30.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PITX2 and CTNNB1. HeLa cells were stained with anti-PITX2 rabbit purified polyclonal 1:1200 and anti-CTNNB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — PITX2
Entrez GeneID
5308GeneBank Accession#
NM_153427.1Protein Accession#
NP_700476.1Gene Name
PITX2
Gene Alias
ARP1, Brx1, IDG2, IGDS, IGDS2, IHG2, IRID2, MGC111022, MGC20144, Otlx2, PTX2, RGS, RIEG, RIEG1, RS
Gene Description
paired-like homeodomain 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000163736|all1-responsive gene 1|paired-like homeodomain transcription factor 2|pituitary homeo box 2|rieg bicoid-related homeobox transcription factor 1|solurshin
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com