PIK3R1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PIK3R1 partial ORF ( NP_852556, 251 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
IQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PIK3R1
Entrez GeneID
5295GeneBank Accession#
NM_181504Protein Accession#
NP_852556Gene Name
PIK3R1
Gene Alias
GRB1, p85, p85-ALPHA
Gene Description
phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
Omim ID
171833Gene Ontology
HyperlinkGene Summary
Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha)|phosphatidylinositol 3-kinase, regulatory, 1|phosphatidylinositol 3-kinase-associated p-85 alpha|phosphoinositide-3-kinase, regulatory subunit 1 (p85 alpha)|phosphoinositide-3-ki
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com