Product Browser
 
  • Related Product Showcase
  • By Research Area
  • By Pathway
  • By Disease
  • By Biomarker
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

PIK3R1 polyclonal antibody (A01)   

  • Catalog # : H00005295-A01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 uL
  • USD $ 229
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PIK3R1.
  • Immunogen:
  • PIK3R1 (NP_852556, 251 a.a. ~ 360 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • IQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005295-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5295
  • Gene Name:
  • PIK3R1
  • Gene Alias:
  • GRB1,p85,p85-ALPHA
  • Gene Description:
  • phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
  • Gene Summary:
  • Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha),phosphatidylinositol 3-kinase, regulatory, 1,phosphatidylinositol 3-kinase-associated p-85 alpha,phosphoinositide-3-kinase, regulatory subunit 1 (p85 alpha),phosphoinositide-3-ki
  • Interactome
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!