PIK3CG monoclonal antibody (M02), clone 2G3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PIK3CG.
Immunogen
PIK3CG (AAH35683, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIK3CG is approximately 10ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between KIT and PIK3CG. HeLa cells were stained with anti-KIT rabbit purified polyclonal 1:1200 and anti-PIK3CG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to PIK3CG on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PIK3CG
Entrez GeneID
5294GeneBank Accession#
BC035683Protein Accession#
AAH35683Gene Name
PIK3CG
Gene Alias
PI3CG, PI3K, PI3Kgamma, PIK3
Gene Description
phosphoinositide-3-kinase, catalytic, gamma polypeptide
Omim ID
601232Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that belongs to the pi3/pi4-kinase family of proteins. The gene product is an enzyme that phosphorylates phosphoinositides on the 3-hydroxyl group of the inositol ring. It is an important modulator of extracellular signals, including those elicited by E-cadherin-mediated cell-cell adhesion, which plays an important role in maintenance of the structural and functional integrity of epithelia. In addition to its role in promoting assembly of adherens junctions, the protein is thought to play a pivotal role in the regulation of cytotoxicity in NK cells. The gene is located in a commonly deleted segment of chromosome 7 previously identified in myeloid leukemias. [provided by RefSeq
Other Designations
1-phosphatidylinositol 3-kinase|PI3-kinase|PTDINS-3-kinase|p110-gamma|phosphatidylinositol 3 kinase gamma, p110 gamma|phosphatidylinositol 3-kinase catalytic 110-kD gamma|phosphatidylinositol 3-kinase, catalytic, gamma polypeptide|phosphoinositide-3-kinas
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com