Product Browser

Last updated: 2014/10/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIK3CB monoclonal antibody (M03), clone 10D5

  • Catalog # : H00005291-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PIK3CB.
  • Immunogen:
  • PIK3CB (NP_006210, 147 a.a. ~ 256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005291-M03
    Western Blot detection against Immunogen (37.84 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged PIK3CB is approximately 30ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and PIK3CB HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-PIK3CB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5291
  • Gene Name:
  • PIK3CB
  • Gene Alias:
  • DKFZp779K1237,MGC133043,PI3K,PI3KCB,PI3Kbeta,PIK3C1,p110-BETA
  • Gene Description:
  • phosphoinositide-3-kinase, catalytic, beta polypeptide
  • Gene Summary:
  • Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993 [PubMed 8246984]).[supplied by OMIM
  • Other Designations:
  • PI3-kinase p110 subunit beta,PtdIns-3-kinase p110,phosphatidylinositol 3-kinase, catalytic, beta polypeptide
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook