Product Browser

Last updated: 2014/7/21

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SERPINB9 (Human) Recombinant Protein (P01)

  • Catalog # : H00005272-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SERPINB9 full-length ORF ( AAH02538, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 67.10
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005272-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5272
  • Gene Name:
  • SERPINB9
  • Gene Alias:
  • CAP-3,CAP3,PI9
  • Gene Description:
  • serpin peptidase inhibitor, clade B (ovalbumin), member 9
  • Gene Summary:
  • PI9 belongs to the large superfamily of serine proteinase inhibitors (serpins), which bind to and inactivate serine proteinases. These interactions are involved in many cellular processes, including coagulation, fibrinolysis, complement fixation, matrix remodeling, and apoptosis (Sprecher et al., 1995 [PubMed 8530382]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000015954,protease inhibitor 9 (ovalbumin type),serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9
  • RSS
  • YouTube
  • Linkedin
  • Facebook