Product Browser

Last updated: 2014/10/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SERPINB9 polyclonal antibody (A01)

  • Catalog # : H00005272-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SERPINB9.
  • Immunogen:
  • SERPINB9 (NP_004146, 279 a.a. ~ 375 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005272-A01
    Western Blot detection against Immunogen (36.78 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5272
  • Gene Name:
  • SERPINB9
  • Gene Alias:
  • CAP-3,CAP3,PI9
  • Gene Description:
  • serpin peptidase inhibitor, clade B (ovalbumin), member 9
  • Gene Summary:
  • PI9 belongs to the large superfamily of serine proteinase inhibitors (serpins), which bind to and inactivate serine proteinases. These interactions are involved in many cellular processes, including coagulation, fibrinolysis, complement fixation, matrix remodeling, and apoptosis (Sprecher et al., 1995 [PubMed 8530382]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000015954,protease inhibitor 9 (ovalbumin type),serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9
  • RSS
  • YouTube
  • Linkedin
  • Facebook