PFKFB3 monoclonal antibody (M08), clone 3F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PFKFB3.
Immunogen
PFKFB3 (NP_004557, 412 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (74)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PFKFB3 expression in transfected 293T cell line by PFKFB3 monoclonal antibody (M08), clone 3F3.
Lane 1: PFKFB3 transfected lysate(59.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of PFKFB3 transfected lysate using anti-PFKFB3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PFKFB3 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PFKFB3 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — PFKFB3
Entrez GeneID
5209GeneBank Accession#
NM_004566Protein Accession#
NP_004557Gene Name
PFKFB3
Gene Alias
IPFK2, PFK2
Gene Description
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
Omim ID
605319Gene Ontology
HyperlinkGene Summary
O
Other Designations
6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase|6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase|OTTHUMP00000019040|OTTHUMP00000044861|fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase|inducible 6-phosphofructo-2-kinase/fructose-2,6-bi
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Differential role of neuronal glucose and PFKFB3 in memory formation during development.
Emmanuel Cruz, Benjamin Bessières, Pierre Magistretti, Cristina M Alberini.
Glia 2022 Nov; 70(11):2207.
Application:WB-Ce, Rat, Rat dorsal hippocampus.
-
Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry.
Ohmura M, Hishiki T, Yamamoto T, Nakanishi T, Kubo A, Tsuchihashi K, Tamada M, Toue S, Kabe Y, Saya H, Suematsu M.
Nitric Oxide : Biology and Chemistry 2015 Apr; 46:102.
Application:WB, Human, HCT116 cells.
-
Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway.
Yamamoto T, Takano N, Ishiwata K, Ohmura M, Nagahata Y, Matsuura T, Kamata A, Sakamoto K, Nakanishi T, Kubo A, Hishiki T, Suematsu M.
Nature Communications 2014 Mar; 5:3480.
Application:WB-Ce, Recombinant protein.
-
Energy management by enhanced glycolysis in G1 phase in human colon cancer cells in vivo and in vitro.
Bao Y, Mukai K, Hishiki T, Kubo A, Ohmura M, Sugiura Y, Matsuura T, Nagahata Y, Hayakawa N, Yamamoto T, Fukuda R, Saya H, Suematsu M, Minamishima YA.
Molecular Cancer Research 2013 Sep; 11(9):973.
Application:WB-Tr, Human, HCT116 cells.
-
Differential role of neuronal glucose and PFKFB3 in memory formation during development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com