PEX10 monoclonal antibody (M01), clone 1B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PEX10 expression in transfected 293T cell line by PEX10 monoclonal antibody (M01), clone 1B8.
Lane 1: PEX10 transfected lysate(37.069 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PEX10 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (61.6 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PEX10.
Immunogen
PEX10 (AAH18198.1, 1 a.a. ~ 326 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGITYLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLYGFRQRQRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (85)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (61.6 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PEX10 expression in transfected 293T cell line by PEX10 monoclonal antibody (M01), clone 1B8.
Lane 1: PEX10 transfected lysate(37.069 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PEX10 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — PEX10
Entrez GeneID
5192GeneBank Accession#
BC018198Protein Accession#
AAH18198.1Gene Name
PEX10
Gene Alias
MGC1998, NALD, RNF69
Gene Description
peroxisomal biogenesis factor 10
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000001658|peroxin 10|peroxisome assembly protein 10|peroxisome biogenesis factor 10
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com