PDGFB purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PDGFB protein.
Immunogen
PDGFB (NP_002599, 1 a.a. ~ 241 a.a) full-length human protein.
Sequence
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PDGFB MaxPab polyclonal antibody. Western Blot analysis of PDGFB expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of PDGFB expression in transfected 293T cell line (H00005155-T01) by PDGFB MaxPab polyclonal antibody.
Lane 1: PDGFB transfected lysate(26.51 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PDGFB
Entrez GeneID
5155GeneBank Accession#
NM_002608.1Protein Accession#
NP_002599Gene Name
PDGFB
Gene Alias
FLJ12858, PDGF2, SIS, SSV, c-sis
Gene Description
platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Omim ID
190040Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
PDGF, B chain|Platelet-derived growth factor, beta polypeptide (oncogene SIS)|becaplermin|oncogene SIS|platelet-derived growth factor 2|platelet-derived growth factor beta|platelet-derived growth factor, B chain|v-sis platelet-derived growth factor beta p
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com