PBX2 monoclonal antibody (M01), clone 2E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PBX2 monoclonal antibody (M01), clone 2E9 Western Blot analysis of PBX2 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of PBX2 expression in transfected 293T cell line by PBX2 monoclonal antibody (M01), clone 2E9.
Lane 1: PBX2 transfected lysate(45.9 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of PBX2 over-expressed 293 cell line, cotransfected with PBX2 Validated Chimera RNAi ( Cat # H00005089-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PBX2 monoclonal antibody (M01), clone 2E9 (Cat # H00005089-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PBX2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (34.21 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PBX2.
Immunogen
PBX2 (NP_002577, 354 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.21 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PBX2 monoclonal antibody (M01), clone 2E9 Western Blot analysis of PBX2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of PBX2 expression in transfected 293T cell line by PBX2 monoclonal antibody (M01), clone 2E9.
Lane 1: PBX2 transfected lysate(45.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PBX2 over-expressed 293 cell line, cotransfected with PBX2 Validated Chimera RNAi ( Cat # H00005089-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PBX2 monoclonal antibody (M01), clone 2E9 (Cat # H00005089-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to PBX2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PBX2
Entrez GeneID
5089GeneBank Accession#
NM_002586Protein Accession#
NP_002577Gene Name
PBX2
Gene Alias
G17, HOX12, PBX2MHC
Gene Description
pre-B-cell leukemia homeobox 2
Omim ID
176311Gene Ontology
HyperlinkGene Summary
This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6. [provided by RefSeq
Other Designations
OTTHUMP00000029151|homeobox 12|pre-B-cell leukemia transcription factor 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com