PAFAH2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PAFAH2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PAFAH2 expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of PAFAH2 expression in transfected 293T cell line (H00005051-T01) by PAFAH2 MaxPab polyclonal antibody.
Lane 1: PAFAH2 transfected lysate(44.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PAFAH2 protein.
Immunogen
PAFAH2 (NP_000428.2, 1 a.a. ~ 392 a.a) full-length human protein.
Sequence
MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PAFAH2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PAFAH2 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of PAFAH2 expression in transfected 293T cell line (H00005051-T01) by PAFAH2 MaxPab polyclonal antibody.
Lane 1: PAFAH2 transfected lysate(44.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PAFAH2
Entrez GeneID
5051GeneBank Accession#
NM_000437.2Protein Accession#
NP_000428.2Gene Name
PAFAH2
Gene Alias
FLJ26025, HSD-PLA2
Gene Description
platelet-activating factor acetylhydrolase 2, 40kDa
Omim ID
602344Gene Ontology
HyperlinkGene Summary
This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme. [provided by RefSeq
Other Designations
OTTHUMP00000008596|platelet-activating factor acetylhydrolase 2|platelet-activating factor acetylhydrolase 2 (40kD)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com