TNFRSF11B purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TNFRSF11B MaxPab polyclonal antibody. Western Blot analysis of TNFRSF11B expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of TNFRSF11B expression in transfected 293T cell line (H00004982-T01) by TNFRSF11B MaxPab polyclonal antibody.
Lane 1: TNFRSF11B transfected lysate(44.11 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TNFRSF11B protein.
Immunogen
TNFRSF11B (AAH30155.1, 1 a.a. ~ 401 a.a) full-length human protein.
Sequence
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TNFRSF11B MaxPab polyclonal antibody. Western Blot analysis of TNFRSF11B expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of TNFRSF11B expression in transfected 293T cell line (H00004982-T01) by TNFRSF11B MaxPab polyclonal antibody.
Lane 1: TNFRSF11B transfected lysate(44.11 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TNFRSF11B
Entrez GeneID
4982GeneBank Accession#
BC030155Protein Accession#
AAH30155.1Gene Name
TNFRSF11B
Gene Alias
MGC29565, OCIF, OPG, TR1
Gene Description
tumor necrosis factor receptor superfamily, member 11b
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined. [provided by RefSeq
Other Designations
osteoclastogenesis inhibitory factor|osteoprotegerin
-
Interactome
-
Pathway
-
Disease
- Acute Disease
- Alveolar Bone Loss
- Alzheimer disease
- Arthritis
- Asthma
- Body Weight
- Bone Diseases
- Brain Ischemia
- Calcinosis
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com