Product Browser

Last updated: 2014/9/15
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NOV MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00004856-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NOV protein.
  • Immunogen:
  • NOV (AAH15028.1, 1 a.a. ~ 357 a.a) full-length human protein.
  • Sequence:
  • MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • NOV MaxPab rabbit polyclonal antibody. Western Blot analysis of NOV expression in HeLa.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NOV expression in transfected 293T cell line (H00004856-T02) by NOV MaxPab polyclonal antibody.

    Lane 1: NOV transfected lysate(39.2 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of NOV transfected lysate using anti-NOV MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NOV purified MaxPab mouse polyclonal antibody (B01P) (H00004856-B01P).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 4856
  • Gene Name:
  • NOV
  • Gene Alias:
  • CCN3,IGFBP9
  • Gene Description:
  • nephroblastoma overexpressed gene
  • Gene Summary:
  • The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq
  • Other Designations:
  • nephroblastoma overexpressed
  • RSS
  • YouTube
  • Linkedin
  • Facebook