Product Browser
 
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

NF2 (Human) Recombinant Protein (P01)   

  • Catalog # : H00004771-P01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 10 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • 25 ug
  • USD $ 485
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Human NF2 full-length ORF ( AAH07279, 1 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MVVSLRALLLALRQKPHSTGTIHEVTAQLMMSVRLSFWPVAVCSCVAQMASFILIKAPPQPQQSPQPVLSTLLFMYLPGPAR
  • Theoretical MW (kDa):
  • 34.76
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004771-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4771
  • Gene Name:
  • NF2
  • Gene Alias:
  • ACN,BANF,SCH
  • Gene Description:
  • neurofibromin 2 (merlin)
  • Gene Summary:
  • This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts. [provided by RefSeq
  • Other Designations:
  • merlin,moesin-ezrin-radixin like,moesin-ezrin-radizin-like protein,neurofibromin 2,neurofibromin 2 (bilateral acoustic neuroma),schwannomerlin,schwannomin
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!