- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
- By Disease
- By Antibody/Protein
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > MaxPab® Ab > Human > Membrane > Transporter > NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)
NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P) 
- Catalog # : H00004712-D01P
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 359
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Rabbit polyclonal antibody raised against a full-length human NDUFB6 protein.
- Immunogen:
- NDUFB6 (NP_002484.1, 1 a.a. ~ 128 a.a) full-length human protein.
- Sequence:
- MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
- Host:
- Rabbit
- Reactivity:
- Human, Mouse
- Quality Control Testing:
- Antibody reactive against mammalian transfected lysate.
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Applications
- Western Blot (Tissue lysate)
- NDUFB6 MaxPab rabbit polyclonal antibody. Western Blot analysis of NDUFB6 expression in mouse kidney.
- Protocol Download
- Western Blot (Transfected lysate)
- Western Blot analysis of NDUFB6 expression in transfected 293T cell line (H00004712-T01) by NDUFB6 MaxPab polyclonal antibody.
Lane 1: NDUFB6 transfected lysate(15.50 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- Entrez GeneID:
- 4712
- GeneBank Accession#:
- NM_002493.3
- Protein Accession#:
- NP_002484.1
- Gene Name:
- NDUFB6
- Gene Alias:
- B17,CI,MGC13675
- Gene Description:
- NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
- Omim ID:
- 603322
- Gene Ontology:
- Hyperlink
- Gene Summary:
- The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
- Other Designations:
- NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17),NADH-ubiquinone oxidoreductase B17 subunit,NADH-ubiquinone oxidoreductase beta subunit, 6,OTTHUMP00000021179,OTTHUMP00000021180,complex I, mitochondrial respiratory chain, B17 subunit
