Product Browser

Last updated: 2014/7/21
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004712-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NDUFB6 protein.
  • Immunogen:
  • NDUFB6 (NP_002484.1, 1 a.a. ~ 128 a.a) full-length human protein.
  • Sequence:
  • MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • NDUFB6 MaxPab rabbit polyclonal antibody. Western Blot analysis of NDUFB6 expression in mouse kidney.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NDUFB6 expression in transfected 293T cell line (H00004712-T01) by NDUFB6 MaxPab polyclonal antibody.

    Lane 1: NDUFB6 transfected lysate(15.50 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 4712
  • Gene Name:
  • NDUFB6
  • Gene Alias:
  • B17,CI,MGC13675
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
  • Gene Summary:
  • The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17),NADH-ubiquinone oxidoreductase B17 subunit,NADH-ubiquinone oxidoreductase beta subunit, 6,OTTHUMP00000021179,OTTHUMP00000021180,complex I, mitochondrial respiratory chain, B17 subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook