NAP1L1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NAP1L1 MaxPab polyclonal antibody. Western Blot analysis of NAP1L1 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of NAP1L1 expression in transfected 293T cell line (H00004673-T03) by NAP1L1 MaxPab polyclonal antibody.
Lane 1: NAP1L1 transfected lysate(43.01 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NAP1L1 protein.
Immunogen
NAP1L1 (NP_004528.1, 1 a.a. ~ 391 a.a) full-length human protein.
Sequence
MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NAP1L1 MaxPab polyclonal antibody. Western Blot analysis of NAP1L1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of NAP1L1 expression in transfected 293T cell line (H00004673-T03) by NAP1L1 MaxPab polyclonal antibody.
Lane 1: NAP1L1 transfected lysate(43.01 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NAP1L1
Entrez GeneID
4673GeneBank Accession#
NM_004537Protein Accession#
NP_004528.1Gene Name
NAP1L1
Gene Alias
FLJ16112, MGC23410, MGC8688, NAP1, NAP1L, NRP
Gene Description
nucleosome assembly protein 1-like 1
Omim ID
164060Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing of this gene results in several transcript variants; however, not all have been fully described. [provided by RefSeq
Other Designations
HSP22-like protein interacting protein|NAP-1 related protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com