Product Browser

Last updated: 2014/9/29
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYB polyclonal antibody (A01)

  • Catalog # : H00004602-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MYB.
  • Immunogen:
  • MYB (AAH64955, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • FCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004602-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MYB polyclonal antibody (A01), Lot # 050727JC01 Western Blot analysis of MYB expression in HepG2 ( Cat # L019V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4602
  • Gene Name:
  • MYB
  • Gene Alias:
  • Cmyb,c-myb,c-myb_CDS,efg
  • Gene Description:
  • v-myb myeloblastosis viral oncogene homolog (avian)
  • Gene Summary:
  • This gene encodes a transcription factor that is a member of the MYB family of transcription factor genes. The protein contains three domains, an N-terminal DNA-binding domain, a central transcriptional activation domain and a C-terminal domain involved in transcriptional repression. This protein plays an essential role in the regulation of hematopoiesis and may play a role in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • Avian myeloblastosis viral (v-myb) oncogene homolog,OTTHUMP00000017258,c-myb protein (140 AA),c-myb10A_CDS,c-myb13A_CDS,c-myb14A_CDS,c-myb8B_CDS,v-myb avian myeloblastosis viral oncogene homolog,v-myb myeloblastosis viral oncogene homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook