MRC1 monoclonal antibody (M02), clone 5C11(H00004360-M02)

MRC1 monoclonal antibody (M02), clone 5C11

Catalog # H00004360-M02

* Location

Size

Price

Stock

Quantity

Size:100 ug

Price: USD $ 335.00

Stock：

order now, ship in 3 months

* The price is valid only in USA. Please select country.

Hello Spring Sale - Blossom with Savings!

Contact Info

+1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098
+1-909-992-3401
sales@abnova.com

Product Inquiry

Bulk Inquiry

Service Inquiry

Add to Interest Products

Compare (Max 4)

Datasheet
MSDS
More Files
- Datasheet
- MSDS
Print / PDF
Write a Review
More Functions
- Print / PDF
- Write a Review

Images

Application

Western Blot (Tissue lysate)

MRC1 monoclonal antibody (M02), clone 5C11. Western Blot analysis of MRC1 expression in human pancreas.

Protocol Download

Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to MRC1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]

Protocol Download

Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged MRC1 is approximately 0.03ng/ml as a capture antibody.

Protocol Download

QC Test

Western Blot detection against Immunogen (37.73 KDa) .

Specification

Product Description

Mouse monoclonal antibody raised against a partial recombinant MRC1.

Immunogen

MRC1 (NP_002429, 22 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence

TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY

Host

Mouse

Reactivity

Human

Interspecies Antigen Sequence

Mouse (84); Rat (85)

Isotype

IgG1 Kappa

Quality Control Testing

Antibody Reactive Against Recombinant Protein.

Western Blot detection against Immunogen (37.73 KDa) .

Storage Buffer

In 1x PBS, pH 7.4

Storage Instruction

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Applications

Western Blot (Tissue lysate)
MRC1 monoclonal antibody (M02), clone 5C11. Western Blot analysis of MRC1 expression in human pancreas.
Protocol Download

Western Blot (Recombinant protein)

Protocol Download

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MRC1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]
Protocol Download

Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MRC1 is approximately 0.03ng/ml as a capture antibody.
Protocol Download

ELISA
Gene Info — MRC1

Entrez GeneID
4360

GeneBank Accession#
NM_002438

Protein Accession#
NP_002429

Gene Name

MRC1

Gene Alias

CD206, CLEC13D, MMR

Gene Description

mannose receptor, C type 1

Omim ID
153618

Gene Ontology
Hyperlink

Gene Summary

The recognition of complex carbohydrate structures on glycoproteins is an important part of several biological processes, including cell-cell recognition, serum glycoprotein turnover, and neutralization of pathogens. The protein encoded by this gene is a type I membrane receptor that mediates the endocytosis of glycoproteins by macrophages. The protein has been shown to bind high-mannose structures on the surface of potentially pathogenic viruses, bacteria, and fungi so that they can be neutralized by phagocytic engulfment. This gene is in close proximity to MRC1L1. The gene loci including this gene, MRC1L1, as well as LOC340843 and LOC340893, consist of two nearly identical, tandemly linked genomic regions, which are thought to be a part of a duplicated region. [provided by RefSeq

Other Designations

OTTHUMP00000019245|OTTHUMP00000045206|macrophage mannose receptor|mannose receptor C type 1
Interactome
- MRC1
Disease
Publication Reference
- Multiomic spatial landscape of innate immune cells at human central nervous system borders.
  Roman Sankowski, Patrick Süß, Alexander Benkendorff, Chotima Böttcher, Camila Fernandez-Zapata, Chintan Chhatbar, Jonathan Cahueau, Gianni Monaco, Adrià Dalmau Gasull, Ashkan Khavaran, Jürgen Grauvogel, Christian Scheiwe, Mukesch Johannes Shah, Dieter Henrik Heiland, Oliver Schnell, Filiz Markfeld-Erol, Mirjam Kunze, Robert Zeiser, Josef Priller, Marco Prinz.
  
  Nature Medicine 2024 Jan; 30(1):186.
  
  Application：IF, Human, Human brain tissues, perivascular and leptomeningeal Y+ cells.
- Post-COVID exercise intolerance is associated with capillary alterations and immune dysregulations in skeletal muscles.
  Tom Aschman, Emanuel Wyler, Oliver Baum, Andreas Hentschel, Rebekka Rust, Franziska Legler, Corinna Preusse, Lil Meyer-Arndt, Ivana Büttnerova, Alexandra Förster, Derya Cengiz, Luiz Gustavo Teixeira Alves, Julia Schneider, Claudia Kedor, Judith Bellmann-Strobl, Aminaa Sanchin, Hans-Hilmar Goebel, Markus Landthaler, Victor Corman, Andreas Roos, Frank L Heppner, Helena Radbruch, Friedemann Paul, Carmen Scheibenbogen, Nora F Dengler, Werner Stenzel.
  
  Acta Neuropathologica Communications 2023 Dec; 11(1):193.
  
  Application：IHC, Human, Muscles.
- Macrophage subpopulations in pediatric patients with lupus nephritis and other inflammatory diseases affecting the kidney.
  Mira Sandersfeld, Maike Büttner-Herold, Fulvia Ferrazzi, Kerstin Amann, Kerstin Benz, Christoph Daniel.
  
  Arthritis Research & Therapy 2024 Feb; 26(1):46.
  
  Application：IF, Human, Kidney.
- Comparison of Phenotypes in Subcutaneous Fat and Perivascular Adipose Tissue Surrounding the Saphenous Vein in Coronary Artery Bypass Grafting.
  Takuma Mikami, Masato Furuhashi, Ryosuke Numaguchi, Itaru Hosaka, Akiko Sakai, Marenao Tanaka, Toshiro Ito, Toshiyuki Maeda, Taku Sakurada, Satoshi Muraki, Yousuke Yanase, Hiroshi Sato, Joji Fukada, Yukihiko Tamiya, Yutaka Iba, Nobuyoshi Kawaharada.
  
  Circulation Journal : Official Journal of the Japanese Circulation Society 2023 Feb; [Epub].
  
  Application：IHC-P, Human, Human fat pads.
- Single-cell profiling reveals mechanisms of uncontrolled inflammation and glycolysis in decidual stromal cell subtypes in recurrent miscarriage.
  Shihua Bao, Zechuan Chen, Dengke Qin, Huihui Xu, Xujing Deng, Ruixiu Zhang, Jiaqiang Ma, Zhouping Lu, Shan Jiang, Xiaoming Zhang.
  
  Human Reproduction 2022 Nov; deac240.
  
  Application：IHC, Human, Human decidual.
- Multi-omics characterization reveals the pathogenesis of liver focal nodular hyperplasia.
  Yuming Liu, Jinmai Zhang, Zhuo Wang, Jiaqiang Ma, Ke Wang, Dongning Rao, Mao Zhang, Youpei Lin, Yingcheng Wu, Zijian Yang, Liangqing Dong, Zhenbin Ding, Xiaoming Zhang, Jia Fan, Yongyong Shi, Qiang Gao.
  
  iScience 2022 Sep; 25(9):104921.
  
  Application：IF, Human, Human liver.
- Specification of CNS macrophage subsets occurs postnatally in defined niches.
  Takahiro Masuda, Lukas Amann, Gianni Monaco, Roman Sankowski, Ori Staszewski, Martin Krueger, Francesca Del Gaudio, Liqun He, Neil Paterson, Elisa Nent, Francisco Fernández-Klett, Ayato Yamasaki, Maximilian Frosch, Maximilian Fliegauf, Lance Fredrick Pahutan Bosch, Hatice Ulupinar, Nora Hagemeyer, Dietmar Schreiner, Cayce Dorrier, Makoto Tsuda, Claudia Grothe, Anne Joutel, Richard Daneman, Christer Betsholtz, Urban Lendahl, Klaus-Peter Knobeloch, Tim Lämmermann, Josef Priller, Katrin Kierdorf, M
  
  Nature 2022 Apr; 604(7907):740.
  
  Application：IHC-P, Human, Human fetal brains.
- Cyclic sulfur compounds targeting macrophage polarization into M2/protumor phenotype and their anti-tumor effects.
  Cheng Pan, Yukio Fujiwara, Hasita Horlad, Toyohisa Iriki, Daisuke Shiraishi, Yoshihiro Komohara.
  
  Cancer Immunology, Immunotherapy : CII 2022 Jun; 71(6):1331.
  
  Application：WB-Ce, Human, Human monocyte-derived macrophages.
- Potential role of M2 TAMs around lymphatic vessels during lymphatic invasion in papillary thyroid carcinoma.
  Takanobu Kabasawa, Rintaro Ohe, Naing Ye Aung, Yuka Urano, Takumi Kitaoka, Nobuyuki Tamazawa, Aya Utsunomiya, Mitsunori Yamakawa.
  
  Scientific Reports 2021 Jan; 11(1):1150.
  
  Application：IHC-P, Human, Human papillary thyroid carcinoma.
- The Distribution of Macrophage Subtypes and Their Relationship to Bone Morphogenetic Protein 2 in Calcified Aortic Valve Stenosis.
  Eiichi Oba, Naing Ye Aung, Rintaro Ohe, Mitsuaki Sadahiro, Mitsunori Yamakawa.
  
  American Journal of Translational Research 2020 May; 12(5):1728.
  
  Application：IHC, Human, Aortic valve.
- CD206+ tumor-associated macrophages promote proliferation and invasion in oral squamous cell carcinoma via EGF production.
  Haque ASMR, Moriyama M, Kubota K, Ishiguro N, Sakamoto M, Chinju A, Mochizuki K, Sakamoto T, Kaneko N, Munemura R, Maehara T, Tanaka A, Hayashida JN, Kawano S, Kiyoshima T, Nakamura S.
  
  Scientific Reports 2019 Oct; 9(1):14611.
  
  Application：IHC-P, IF, Human, Oral squamous cell carcinoma.
- Complement receptor-associated CD163+/CD18+/CD11c+/CD206-/CD209- expression profile in chronic histiocytic intervillositis of the placenta.
  Hussein K, Stucki-Koch A, Müller AM, Arnold R, Kreipe H, Feist H.
  
  Placenta 2019 Mar; 78:23.
  
  Application：IHC-P, Human, Human placental samples.
- Differential Phenotypes in Perivascular Adipose Tissue Surrounding the Internal Thoracic Artery and Diseased Coronary Artery.
  Numaguchi R, Furuhashi M, Matsumoto M, Sato H, Yanase Y, Kuroda Y, Harada R, Ito T, Higashiura Y, Koyama M, Tanaka M, Moniwa N, Nakamura M, Doi H, Miura T, Kawaharada N.
  
  Journal of the American Heart Association 2019 Jan; 8(2):e011147.
  
  Application：IHC-P, Human, Perivascular adipose tissues from patients diagnosed with coronary artery disease.
- Macrophages but not Astrocytes Harbor HIV DNA in the Brains of HIV-1-Infected Aviremic Individuals on Suppressive Antiretroviral Therapy.
  Ko A, Kang G, Hattler JB, Galadima HI, Zhang J, Li Q, Kim WK.
  
  Journal of Neuroimmune Pharmacology 2018 Sep; [Epub].
  
  Application：IHC, Human, Brain.
- Galectin 3 expression in regional lymph nodes and lymph node metastases of oral squamous cell carcinomas.
  Wehrhan F, Büttner-Herold M, Distel L, Ries J, Moebius P, Preidl R, Geppert CI, Neukam FW, Kesting M, Weber M.
  
  BMC Cancer 2018 Aug; 18(1):823.
  
  Application：IHC, Human, Oral squamous cell carcinomas.
- Macrophage polarization differs between apical granulomas, radicular cysts, and dentigerous cysts.
  Weber M, Schlittenbauer T, Moebius P, Büttner-Herold M, Ries J, Preidl R, Geppert CI, Neukam FW, Wehrhan F.
  
  Clinical Oral Investigations 2017 May; [Epub].
  
  Application：IHC, Human, Human apical granuloma.
- Optimum immunohistochemical procedures for analysis of macrophages in human and mouse formalin fixed paraffin-embedded tissue samples.
  Nakagawa T, Ohnishi K, Kosaki Y, Saito Y, Horlad H, Fujiwara Y, Takeya M, Komohara Y.
  
  Journal of Clinical and Experimental Hematopathology : JCEH 2017 May; 57(1):31.
  
  Application：IHC-P, Human, Human spleen.
- CD163+ M2c-like macrophages predominate in renal biopsies from patients with lupus nephritis.
  Olmes G, Buttner-Herold M, Ferrazzi F, Distel L, Amann K, Daniel C.
  
  Arthritis Research & Therapy 2016 Apr; 18:90.
  
  Application：IHC, Human, Lupus nephritis.
- Prognostic significance of macrophage polarization in early stage oral squamous cell carcinomas.
  Weber M, Lliopoulos C, Moebius P, Buttner-Herold M, Amann K, Ries J, Preidl R, Neukam FW, Wehrhan F.
  
  Oral Oncology 2016 Jan; 52:75.
  
  Application：IHC, Human, Oral squamous cell carcinomas.
- Macrophage polarisation changes within the time between diagnostic biopsy and tumour resection in oral squamous cell carcinomas-an immunohistochemical study.
  Weber M, Moebius P, Büttner-Herold M, Amann K, Preidl R, Neukam FW, Wehrhan F.
  
  British Journal of Cancer 2015 Jul; 113(3):510.
  
  Application：IHC-P, Human, OSCC tumor.
- Expression of the Mannose Receptor CD206 in HIV and SIV Encephalitis: A Phenotypic Switch of Brain Perivascular Macrophages with Virus Infection.
  Holder GE, McGary CM, Johnson EM, Zheng R, John VT, Sugimoto C, Kuroda MJ, Kim WK.
  
  Journal of Neuroimmune Pharmacology 2014 Dec; 9(5):716.
  
  Application：IHC, IF, Human, Monkey, Brain.
- Super-resolution imaging of C-type lectin spatial rearrangement within the dendritic cell plasma membrane at fungal microbe contact sites.
  Itano MS, Graus MS, Pehlke C, Wester MJ, Liu P, Lidke KA, Thompson NL, Jacobson K, Neumann AK.
  
  Frontiers in Physics 2014 Aug; 2:46.
  
  Application：IF, Human, Dendritic cells.
- Increased malignancy of oral squamous cell carcinomas (oscc) is associated with macrophage polarization in regional lymph nodes - an immunohistochemical study.
  Wehrhan F, Buttner-Herold M, Hyckel P, Moebius P, Preidl R, Distel L, Ries J, Amann K, Schmitt C, Neukam FW, Weber M.
  
  BMC Cancer 2014 Jul; 14:522.
  
  Application：IHC-P, Human, Oral squamous cell carcinoma.
- Alternative activation of laser-captured murine hemophagocytes.
  Canna SW, Costa-Reis P, Bernal WE, Chu N, Sullivan KE, Paessler ME, Behrens EM.
  
  Arthritis & Rheumatology 2014 Jun; 66(6):1666.
  
  Application：IHC-P, Human, Bone marrow.
- Small oral squamous cell carcinomas with nodal lymphogenic metastasis show increased infiltration of M2 polarized macrophages - an immunohistochemical analysis.
  Weber M, Buttner-Herold M, Hyckel P, Moebius P, Distel L, Ries J, Amann K, Neukam FW, Wehrhan F.
  
  Journal of Cranio-Maxillo-Facial Surgery 2014 Oct; 42(7):1087.
  
  Application：IHC-P, Human, Oral squamous cell carcinoma.
- Xanthogranulomatous cholecystitis: a clinicopathological study of its association with gallbladder carcinoma.
  Zhuang PY, Zhu MJ, Wang JD, Zhou XP, Quan ZW, Shen J.
  
  Journal of Digestive Diseases 2013 Jan; 14(1):45.
  
  Application：IHC, Human, Gallbladder.
- Coronary Atherosclerosis Is Associated With Macrophage Polarization in Epicardial Adipose Tissue.
  Hirata Y, Tabata M, Kurobe H, Motoki T, Akaike M, Nishio C, Higashida M, Mikasa H, Nakaya Y, Takanashi S, Igarashi T, Kitagawa T, Sata M.
  
  Journal of the American College of Cardiology 2011 Jul; 58(3):248.
  
  Application：IHC-P, Human, Epicardial adipose tissue.