MDH2 monoclonal antibody (M06), clone 2A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MDH2.
Immunogen
MDH2 (NP_005909, 134 a.a. ~ 246 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MDH2 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — MDH2
Entrez GeneID
4191GeneBank Accession#
NM_005918Protein Accession#
NP_005909Gene Name
MDH2
Gene Alias
M-MDH, MDH, MGC:3559, MOR1
Gene Description
malate dehydrogenase 2, NAD (mitochondrial)
Omim ID
154100Gene Ontology
HyperlinkGene Summary
Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. [provided by RefSeq
Other Designations
mitochondrial malate dehydrogenase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Citrate cycle (TCA cycle)
+ View More Disease
-
Disease
-
Publication Reference
-
Metabolomics-driven approach for the improvement of Chinese Hamster ovary cell growth: overexpression of malate dehydrogenase II.
Chong WP, Reddy SG, Yusufi FN, Lee DY, Wong NS, Heng CK, Yap MG, Ho YS.
Journal of Biotechnology 2010 May; 147(2):116.
Application:WB, Mouse, CHO cells.
-
Metabolomics-driven approach for the improvement of Chinese Hamster ovary cell growth: overexpression of malate dehydrogenase II.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com