MCM3 monoclonal antibody (M03), clone 3E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MCM3.
Immunogen
MCM3 (NP_002379, 699 a.a. ~ 808 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (79)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MCM3 monoclonal antibody (M03), clone 3E1. Western Blot analysis of MCM3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
MCM3 monoclonal antibody (M03), clone 3E1 Western Blot analysis of MCM3 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MCM3 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MCM3
Entrez GeneID
4172GeneBank Accession#
NM_002388Protein Accession#
NP_002379Gene Name
MCM3
Gene Alias
HCC5, MGC1157, P1-MCM3, P1.h, RLFB
Gene Description
minichromosome maintenance complex component 3
Omim ID
602693Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq
Other Designations
DNA polymerase alpha holoenzyme-associated protein P1|DNA replication factor MCM3|MCM3 minichromosome maintenance deficient 3|OTTHUMP00000016600|cervical cancer proto-oncogene 5|hRlf beta subunit|minichromosome maintenance deficient 3|replication licensin
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com