MAGEA11 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MAGEA11 protein.
Immunogen
MAGEA11 (ENSP00000359445, 1 a.a. ~ 319 a.a) full-length human protein.
Sequence
MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (41)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAGEA11 expression in transfected 293T cell line by MAGEA11 MaxPab rabbit polyclonal antibody.
Lane 1: MAGEA11 transfected lysate(35.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MAGEA11
Entrez GeneID
4110GeneBank Accession#
ENST00000370417Protein Accession#
ENSP00000359445Gene Name
MAGEA11
Gene Alias
MAGE-11, MAGE11, MAGEA-11, MGC10511
Gene Description
melanoma antigen family A, 11
Omim ID
300344Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
MAGE-11 antigen|OTTHUMP00000024217|melanoma-associated antigen 11
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com