Product Browser

Last updated: 2014/7/14

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMAD6 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004091-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SMAD6 partial ORF (NP_005576, 285 a.a. - 384 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00004091-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4091
  • Gene Name:
  • SMAD6
  • Gene Alias:
  • HsT17432,MADH6,MADH7
  • Gene Description:
  • SMAD family member 6
  • Gene Summary:
  • The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila 'mothers against decapentaplegic' (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants encoding different isoforms have been found for this gene
  • Other Designations:
  • MAD (mothers against decapentaplegic, Drosophila) homolog 6,MAD, mothers against decapentaplegic homolog 6,Mothers against decapentaplegic, drosophila, homolog of, 6,SMAD, mothers against DPP homolog 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook