Product Browser

Last updated: 2014/11/16
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMAD4 monoclonal antibody (M03), clone 1A5

  • Catalog # : H00004089-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SMAD4.
  • Immunogen:
  • SMAD4 (NP_005350, 56 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • SLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004089-M03
    Western Blot detection against Immunogen (37.84 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4089
  • Gene Name:
  • SMAD4
  • Gene Alias:
  • DPC4,JIP,MADH4
  • Gene Description:
  • SMAD family member 4
  • Other Designations:
  • MAD, mothers against decapentaplegic homolog 4,OTTHUMP00000163548,SMAD, mothers against DPP homolog 4,deleted in pancreatic carcinoma locus 4,mothers against decapentaplegic homolog 4,mothers against decapentaplegic, Drosophila, homolog of, 4
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook