Product Browser

Last updated: 2014/12/14
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMAD3 monoclonal antibody (M22), clone 1D6

  • Catalog # : H00004088-M22
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant SMAD3.
  • Immunogen:
  • SMAD3 (NP_005893, 147 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004088-M22
    Western Blot detection against Immunogen (39.27 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SMAD3 monoclonal antibody (M22), clone 1D6 Western Blot analysis of SMAD3 expression in HeLa ( Cat # L013V1 ).
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M22), clone 1D6.

    Lane 1: SMAD3 transfected lysate(48 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4088
  • Gene Name:
  • SMAD3
  • Gene Alias:
  • DKFZp586N0721,DKFZp686J10186,HSPC193,HsT17436,JV15-2,MADH3,MGC60396
  • Gene Description:
  • SMAD family member 3
  • Gene Summary:
  • The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq
  • Other Designations:
  • MAD, mothers against decapentaplegic homolog 3,SMA- and MAD-related protein 3,SMAD, mothers against DPP homolog 3,mad homolog JV15-2,mad protein homolog,mothers against decapentaplegic homolog 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook