EPCAM (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human EPCAM full-length ORF ( AAH14785.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
60.17
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EPCAM
Entrez GeneID
4072GeneBank Accession#
BC014785.1Protein Accession#
AAH14785.1Gene Name
EPCAM
Gene Alias
17-1A, 323/A3, CD326, CO-17A, CO17-1A, EGP, EGP-2, EGP34, EGP40, ESA, Ep-CAM, GA733-2, HEA125, KS1/4, KSA, M4S1, MH99, MIC18, MK-1, MOC31, TACST-1, TACSTD1, TROP1, hEGP-2
Gene Description
epithelial cell adhesion molecule
Omim ID
185535Gene Ontology
HyperlinkGene Summary
This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq
Other Designations
adenocarcinoma-associated antigen|carcinoma-associated antigen GA733-2|human epithelial glycoprotein-2|membrane component, chromosome 4, surface marker (35kD glycoprotein)|tumor-associated calcium signal transducer 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com