EPCAM purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human EPCAM protein.
Immunogen
EPCAM (NP_002345.1, 1 a.a. ~ 314 a.a) full-length human protein.
Sequence
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EPCAM MaxPab polyclonal antibody. Western Blot analysis of EPCAM expression in human colon.Western Blot (Cell lysate)
EPCAM MaxPab polyclonal antibody. Western Blot analysis of EPCAM expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of EPCAM expression in transfected 293T cell line (H00004072-T02) by EPCAM MaxPab polyclonal antibody.
Lane 1: EPCAM transfected lysate(34.54 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to EPCAM on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — EPCAM
Entrez GeneID
4072GeneBank Accession#
NM_002354.1Protein Accession#
NP_002345.1Gene Name
EPCAM
Gene Alias
17-1A, 323/A3, CD326, CO-17A, CO17-1A, EGP, EGP-2, EGP34, EGP40, ESA, Ep-CAM, GA733-2, HEA125, KS1/4, KSA, M4S1, MH99, MIC18, MK-1, MOC31, TACST-1, TACSTD1, TROP1, hEGP-2
Gene Description
epithelial cell adhesion molecule
Omim ID
185535Gene Ontology
HyperlinkGene Summary
This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq
Other Designations
adenocarcinoma-associated antigen|carcinoma-associated antigen GA733-2|human epithelial glycoprotein-2|membrane component, chromosome 4, surface marker (35kD glycoprotein)|tumor-associated calcium signal transducer 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com