LIMK1 monoclonal antibody (M01), clone 1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LIMK1.
Immunogen
LIMK1 (NP_002305, 548 a.a. ~ 647 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LIMK1 monoclonal antibody (M01), clone 1A8 Western Blot analysis of LIMK1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
LIMK1 monoclonal antibody (M01), clone 1A8. Western Blot analysis of LIMK1 expression in SW-13 ( Cat # L005V1 ).Western Blot (Cell lysate)
LIMK1 monoclonal antibody (M01), clone 1A8. Western Blot analysis of LIMK1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
LIMK1 monoclonal antibody (M01), clone 1A8. Western Blot analysis of LIMK1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
LIMK1 monoclonal antibody (M01), clone 1A8. Western Blot analysis of LIMK1 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to LIMK1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LIMK1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — LIMK1
Entrez GeneID
3984GeneBank Accession#
NM_002314Protein Accession#
NP_002305Gene Name
LIMK1
Gene Alias
LIMK
Gene Description
LIM domain kinase 1
Omim ID
601329Gene Ontology
HyperlinkGene Summary
There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome. [provided by RefSeq
Other Designations
LIM motif-containing protein kinase|OTTHUMP00000025066
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com