ABLIM1 monoclonal antibody (M01J), clone 3A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ABLIM1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
ABLIM1 (NP_002304, 637 a.a. ~ 736 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ABLIM1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — ABLIM1
Entrez GeneID
3983GeneBank Accession#
NM_002313Protein Accession#
NP_002304Gene Name
ABLIM1
Gene Alias
ABLIM, DKFZp781D0148, FLJ14564, KIAA0059, LIMAB1, LIMATIN, MGC1224
Gene Description
actin binding LIM protein 1
Omim ID
602330Gene Ontology
HyperlinkGene Summary
This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
LIM actin-binding protein 1|OTTHUMP00000020530|OTTHUMP00000020531|OTTHUMP00000020536|actin-binding LIM protein 1|actin-binding double-zinc-finger protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com