ABLIM1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ABLIM1 expression in transfected 293T cell line (H00003983-T01) by ABLIM1 MaxPab polyclonal antibody.
Lane 1: ABLIM1 transfected lysate(44.11 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ABLIM1 protein.
Immunogen
ABLIM1 (AAH02448.1, 1 a.a. ~ 401 a.a) full-length human protein.
Sequence
MFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ABLIM1 expression in transfected 293T cell line (H00003983-T01) by ABLIM1 MaxPab polyclonal antibody.
Lane 1: ABLIM1 transfected lysate(44.11 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ABLIM1
Entrez GeneID
3983GeneBank Accession#
BC002448.2Protein Accession#
AAH02448.1Gene Name
ABLIM1
Gene Alias
ABLIM, DKFZp781D0148, FLJ14564, KIAA0059, LIMAB1, LIMATIN, MGC1224
Gene Description
actin binding LIM protein 1
Omim ID
602330Gene Ontology
HyperlinkGene Summary
This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
LIM actin-binding protein 1|OTTHUMP00000020530|OTTHUMP00000020531|OTTHUMP00000020536|actin-binding LIM protein 1|actin-binding double-zinc-finger protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com