- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25895)
- MaxPab® Ab (16205)
- Monoclonal Ab (21428)
- Polyclonal Ab (27861)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7710)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2004)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2136)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (18054)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Binding > Others > LGALS3 monoclonal antibody (M01), clone 3C2-2A3
LGALS3 monoclonal antibody (M01), clone 3C2-2A3
- Catalog # : H00003958-M01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a full length recombinant LGALS3.
- Immunogen:
- LGALS3 (AAH01120, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
- Host:
- Mouse
- Reactivity:
- Human
- Isotype:
- IgG1 kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (53.24 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Applications
- Western Blot (Cell lysate)
- LGALS3 monoclonal antibody (M01), clone 3C2-2A3 Western Blot analysis of LGALS3 expression in Hela ( Cat # L013V1 ).
- Protocol Download
- Western Blot (Transfected lysate)
- Western Blot analysis of LGALS3 expression in transfected 293T cell line by LGALS3 monoclonal antibody (M01), clone 3C2-2A3.
Lane 1: LGALS3 transfected lysate (Predicted MW: 26.2 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
enlarge this image- Immunoperoxidase of monoclonal antibody to LGALS3 on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5 ug/ml]
- Protocol Download
- Immunoprecipitation
- Immunoprecipitation of LGALS3 transfected lysate using anti-LGALS3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with LGALS3 MaxPab rabbit polyclonal antibody.
- Protocol Download
- Sandwich ELISA (Recombinant protein)
- Detection limit for recombinant GST tagged LGALS3 is approximately 0.1ng/ml as a capture antibody.
- Protocol Download
- Entrez GeneID:
- 3958
- GeneBank Accession#:
- BC001120
- Protein Accession#:
- AAH01120
- Gene Name:
- LGALS3
- Gene Alias:
- CBP35,GAL3,GALBP,GALIG,LGALS2,MAC2
- Gene Description:
- lectin, galactoside-binding, soluble, 3
- Omim ID:
- 153619
- Gene Ontology:
- Hyperlink
- Other Designations:
- IgE-binding protein,MAC-2 antigen,carbohydrate-binding protein 35,galactose-specific lectin 3,galectin 3,galectin-3 internal,laminin-binding protein
