LDLR monoclonal antibody (M01), clone 5E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LDLR.
Immunogen
LDLR (NP_000518, 105 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LDLR expression in transfected 293T cell line by LDLR monoclonal antibody (M01), clone 5E7.
Lane 1: LDLR transfected lysate(94.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LDLR is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — LDLR
Entrez GeneID
3949GeneBank Accession#
NM_000527Protein Accession#
NP_000518Gene Name
LDLR
Gene Alias
FH, FHC
Gene Description
low density lipoprotein receptor
Gene Ontology
HyperlinkGene Summary
The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. [provided by RefSeq
Other Designations
LDL receptor|low-density lipoprotein receptor class A domain-containing protein 3
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The expression of LDL receptor in vessels with blood-brain barrier impairment in a stroke-prone hypertensive model.
Ueno M, Wu B, Nakagawa T, Nagai Y, Onodera M, Huang CL, Kusaka T, Kanenishi K, Sakamoto H.
Histochemistry and Cell Biology 2010 Jun; 133(6):669.
Application:WB-Ti, Rat, Rat brains.
-
The expression of LDL receptor in vessels with blood-brain barrier impairment in a stroke-prone hypertensive model.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com