LCK monoclonal antibody (M11), clone 3H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of LCK expression in transfected 293T cell line by LCK monoclonal antibody (M11), clone 3H5.
Lane 1: LCK transfected lysate(58.001 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LCK is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LCK.
Immunogen
LCK (AAH13200, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKA
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LCK expression in transfected 293T cell line by LCK monoclonal antibody (M11), clone 3H5.
Lane 1: LCK transfected lysate(58.001 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LCK is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — LCK
Entrez GeneID
3932GeneBank Accession#
BC013200Protein Accession#
AAH13200Gene Name
LCK
Gene Alias
YT16, p56lck, pp58lck
Gene Description
lymphocyte-specific protein tyrosine kinase
Omim ID
153390Gene Ontology
HyperlinkGene Summary
This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described. [provided by RefSeq
Other Designations
T-lymphocyte specific protein tyrosine kinase p56lck|p56(LSTRA) protein-tyrosine kinase|protein tyrosine kinase|proto-oncogene tyrosine-protein kinase LCK
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com