KRT8 monoclonal antibody (M02), clone 3E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of KRT8 expression in transfected 293T cell line by KRT8 monoclonal antibody (M02), clone 3E3.
Lane 1: KRT8 transfected lysate(53.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KRT8 is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to KRT8 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.29 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KRT8.
Immunogen
KRT8 (NP_002264, 91 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVL
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KRT8 expression in transfected 293T cell line by KRT8 monoclonal antibody (M02), clone 3E3.
Lane 1: KRT8 transfected lysate(53.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KRT8 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to KRT8 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — KRT8
Entrez GeneID
3856GeneBank Accession#
NM_002273Protein Accession#
NP_002264Gene Name
KRT8
Gene Alias
CARD2, CK8, CYK8, K2C8, K8, KO
Gene Description
keratin 8
Gene Ontology
HyperlinkGene Summary
This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. The product of this gene typically dimerizes with keratin 18 to form an intermediate filament in simple single-layered epithelial cells. This protein plays a role in maintaining cellular structural integrity and also functions in signal transduction and cellular differentiation. Mutations in this gene cause cryptogenic cirrhosis. [provided by RefSeq
Other Designations
cytokeratin 8|keratin, type II cytoskeletal 8
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com